Protein Info for PfGW456L13_3134 in Pseudomonas fluorescens GW456-L13

Annotation: Short-chain dehydrogenase/reductase SDR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00106: adh_short" amino acids 7 to 197 (191 residues), 186.5 bits, see alignment E=7.7e-59 PF08659: KR" amino acids 9 to 171 (163 residues), 52.7 bits, see alignment E=1.1e-17 PF01370: Epimerase" amino acids 9 to 92 (84 residues), 22.5 bits, see alignment E=1.4e-08 PF13561: adh_short_C2" amino acids 13 to 203 (191 residues), 134.9 bits, see alignment E=6.9e-43

Best Hits

Swiss-Prot: 41% identical to Y0585_STAHJ: Uncharacterized oxidoreductase SH0585 (SH0585) from Staphylococcus haemolyticus (strain JCSC1435)

KEGG orthology group: None (inferred from 82% identity to pba:PSEBR_a3932)

MetaCyc: 44% identical to clavulanate dehydrogenase subunit (Streptomyces clavuligerus)
RXN-8893

Predicted SEED Role

"Short-chain dehydrogenase/reductase SDR"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QRQ9 at UniProt or InterPro

Protein Sequence (245 amino acids)

>PfGW456L13_3134 Short-chain dehydrogenase/reductase SDR (Pseudomonas fluorescens GW456-L13)
MSNISKKVVLITGASSGIGEATARLLASKGAHVVLGARRTERLEILCAEINARGGSAHFQ
ALDVTRRADVQGFVDFALDLHGRVDVMVNNAGVMPLSKLEALKVREWDQMIDVNIRGVLH
GIAAGLPLMQKQQSGQFINIASIGAYTVSPTASVYCATKFAVRAISEGLRQEVGGDIRVT
VISPGVTESELAESISDEGGRAEMREFRKITIPAMAVARAIAYAIEQPADVDVSELIVRP
TASPF