Protein Info for PfGW456L13_3113 in Pseudomonas fluorescens GW456-L13

Annotation: Creatinine amidohydrolase (EC 3.5.2.10)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF02633: Creatininase" amino acids 3 to 243 (241 residues), 191.3 bits, see alignment E=9.7e-61 TIGR04448: creatininase" amino acids 4 to 247 (244 residues), 370.4 bits, see alignment E=2.3e-115

Best Hits

KEGG orthology group: K01470, creatinine amidohydrolase [EC: 3.5.2.10] (inferred from 77% identity to psa:PST_1998)

Predicted SEED Role

"Creatinine amidohydrolase (EC 3.5.2.10)" (EC 3.5.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QQM8 at UniProt or InterPro

Protein Sequence (263 amino acids)

>PfGW456L13_3113 Creatinine amidohydrolase (EC 3.5.2.10) (Pseudomonas fluorescens GW456-L13)
MDNISWVDYEHRVQSGSVVFLPIGATEQHGPHLPLGTDALLASAISEDVAREIDGIVAPA
LSYGYKSQPKCGGGQHFCGTTSVDGATLIAMVRDAVREFHRHGVTRLVLVIGHYENQWFV
TEGIELAMRDIGPNAGLEVMRLEHWEFVKSQTLDRIFPDGFPGIALEHAAVIETSMMLHY
YPQLVFLDQIPDHGPAQFPVYDMYPARTEWVPASGVLSSALDSSADKGRWLVDDVISGIA
KAVRFEFGLDSIQGQATSNVATP