Protein Info for PfGW456L13_310 in Pseudomonas fluorescens GW456-L13

Annotation: Glucans biosynthesis glucosyltransferase H (EC 2.4.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 837 transmembrane" amino acids 124 to 141 (18 residues), see Phobius details amino acids 179 to 202 (24 residues), see Phobius details amino acids 498 to 525 (28 residues), see Phobius details amino acids 552 to 576 (25 residues), see Phobius details amino acids 588 to 623 (36 residues), see Phobius details amino acids 649 to 686 (38 residues), see Phobius details PF00535: Glycos_transf_2" amino acids 231 to 413 (183 residues), 71.3 bits, see alignment E=1.4e-23 PF13506: Glyco_transf_21" amino acids 323 to 452 (130 residues), 24.2 bits, see alignment E=3.3e-09 PF13632: Glyco_trans_2_3" amino acids 327 to 526 (200 residues), 41.1 bits, see alignment E=2.7e-14

Best Hits

Swiss-Prot: 96% identical to OPGH_PSEPF: Glucans biosynthesis glucosyltransferase H (opgH) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03669, membrane glycosyltransferase [EC: 2.4.1.-] (inferred from 96% identity to pfo:Pfl01_0374)

Predicted SEED Role

"Glucans biosynthesis glucosyltransferase H (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QJ29 at UniProt or InterPro

Protein Sequence (837 amino acids)

>PfGW456L13_310 Glucans biosynthesis glucosyltransferase H (EC 2.4.1.-) (Pseudomonas fluorescens GW456-L13)
MTDQQRAELAGCRSFSELHERLSSSTFDAPAEAAQASVGKRLTLSTAEELQDAEMLVLDA
SGRVCLKATPPIRRTKVVPEPWRTNILVRGWRRLTGRTNPPKPPKDENVLPAARWRTVGS
IRRYILLVLMLGQTIVAGWFMKGLMPYQGWSFVDLDEVLHQPLLQTATQVLPYALQTSIL
ILFGILFCWVSAGFWTALMGFLELLTGHDKYRISGKSAGNEPIPKDARTALVMPICNEDV
PRVFAGLRATFESVAATGDLDRFDFFVLSDSNDADICVAEQQAWLDVCREAGGFGKIFYR
RRRRRVKRKSGNLDDFCRRWGGDYKYMVVLDADSVMSGECLTSLVRLMEATPDAGIIQTA
PRASGMDTLYARMQQFATRVYGPLFTAGLHFWQLGESHYWGHNAIIRMKPFIEHCALAPL
PGKGAFAGAILSHDFVEAALMRRAGWGVWIAYDLPGSYEELPPNLLDELKRDRRWCHGNL
MNFRLFLVKGMHPVHRAVFLTGVMSYLSAPLWFFFLVLSTALLAVNTLMEPQYFLEPRQL
YPLWPQWHPDKAIALFSTTIVLLFLPKLLSIILIWAKGAKEFGGKFKVTLSMLLEMLFSM
LLAPVRMIFHTRFVLAAFLGWAATWNSPQRDDDSTPWSEAVKRHGPQTLLGFFWALLVIW
LNPSFLWWLVPIVGSLMLSIPVSVISSRVGLGLKSRDENLFLIPEEYNPPQALLATDQYT
HENRWHALSDGFVRSVVDPQQNALACSLATSRHREAEPIEWLRVERVRHAMKVGPEGLTN
NERVQLLSDPVALARLHEQVWNEGHPEWLGAWRKSVKADPHAPLLPLKPLSVQPQLA