Protein Info for PfGW456L13_3004 in Pseudomonas fluorescens GW456-L13

Annotation: Cell surface protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 TIGR02608: delta-60 repeat domain" amino acids 41 to 88 (48 residues), 27 bits, see alignment 1.6e-10 amino acids 100 to 149 (50 residues), 18.6 bits, see alignment 6.3e-08 amino acids 171 to 221 (51 residues), 28.9 bits, see alignment 4e-11 amino acids 232 to 277 (46 residues), 31.4 bits, see alignment 6.4e-12 amino acids 342 to 387 (46 residues), 23.8 bits, see alignment 1.5e-09 amino acids 396 to 427 (32 residues), 15.4 bits, see alignment (E = 6.7e-07) PF17164: DUF5122" amino acids 50 to 81 (32 residues), 14.7 bits, see alignment (E = 1.5e-06) amino acids 236 to 268 (33 residues), 23.3 bits, see alignment (E = 3.1e-09) amino acids 346 to 380 (35 residues), 14.6 bits, see alignment 1.6e-06

Best Hits

KEGG orthology group: None (inferred from 67% identity to pfo:Pfl01_2590)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QLH7 at UniProt or InterPro

Protein Sequence (429 amino acids)

>PfGW456L13_3004 Cell surface protein (Pseudomonas fluorescens GW456-L13)
MSSQSAFAYSATRKNAGALDTTFAANGKTQVYFADSLFSLANDVAIDAQGRLLVAAKVGM
ADGTRFGLARLLADGCADLTFGKQGSVIGQFEPGFEAMGTKVLILPDGNILLAGLQYVNA
HRTLPALALLDQDGRLVQGFGDNGRRVVRLPGDLSLGMRDIRLPLGVPGAEACDVAIQQD
GRILILANHHYELADHVGMLIRLDVEGSLDCSFNDRGFVMVRHLLMNTWLSSLTVQRDGR
ILVGGSINFPEEGLLARYHPDGRLDDRFAVDGFMTFKAQGHGARVSRVVQQNEGEILCFG
SSREPMHCLTFKMHSNGRPDSHCNGGHPQRREIGYSGCQWTAAQLQPDGSVLTAGATIGG
VEADFILGRYLPNGLPDRRFGKGSGYTRTRLGPSLDTATCVAAHADGNIVVGGYSLHGNY
KAVIARFQG