Protein Info for PfGW456L13_2999 in Pseudomonas fluorescens GW456-L13

Annotation: UPF0141 membrane protein YijP possibly required for phosphoethanolamine modification of lipopolysaccharide

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 578 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 35 to 36 (2 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 72 to 93 (22 residues), see Phobius details amino acids 122 to 141 (20 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details PF00884: Sulfatase" amino acids 239 to 526 (288 residues), 182 bits, see alignment E=8.6e-58

Best Hits

KEGG orthology group: None (inferred from 90% identity to pfo:Pfl01_2584)

Predicted SEED Role

"UPF0141 membrane protein YijP possibly required for phosphoethanolamine modification of lipopolysaccharide" in subsystem Lipid A modifications

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QQB4 at UniProt or InterPro

Protein Sequence (578 amino acids)

>PfGW456L13_2999 UPF0141 membrane protein YijP possibly required for phosphoethanolamine modification of lipopolysaccharide (Pseudomonas fluorescens GW456-L13)
MSLLKRSNTTAAGFDWAGFVWLFVFFWYFSGITQLLIQLTGTSGFSGFRQAFVMSAFWLA
PMLLFPRQTRVMAAVIGVVLWACSMASLGYFFIYQQEFSQSVIFIMFESNVAEAGEYMTQ
YFAWWMVPAFLAHTAFSWFLWTRLRPVYLPRGKAIVAAVAIVMAVVGYPLIKQTARTGSF
AEGFDKFETRIEPAVPWQMAVAYHRYLETLAGMQDMLNNASKIPPLHNLKDAMANTPATL
VLVIGESTNRQRMSLYGYPRATTPELDKLKDQLDVFDNVITPRPYTIEALQQVLTFADEE
NPDLYLSTPSLVSMMKQAGYKTFWITNQQTMTKRNTMLTTFSEQADEQVYLNNNRNQNAA
QYDGDVIEPFNKALADGAPRKLIVVHLLGTHMSYQYRYPSTFDRFQDREGVPAGIRDDQL
PTYNSYDNAVLYNDFVVSSLIKDYARTDPNGFLLYLSDHGEDVFDSMGHNTLGRNENKPT
APMYTIPFMAWASPKWRATHDWNLVGDLSRPYSSSHLIHTWADLAGLSFDELDRSKSLVS
DSFKARPLMIGNPYERQQRALIDFSLMKPKTPPTVVQQ