Protein Info for PfGW456L13_2954 in Pseudomonas fluorescens GW456-L13

Annotation: RND efflux system, inner membrane transporter CmeB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1032 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 339 to 358 (20 residues), see Phobius details amino acids 365 to 387 (23 residues), see Phobius details amino acids 393 to 413 (21 residues), see Phobius details amino acids 437 to 457 (21 residues), see Phobius details amino acids 473 to 496 (24 residues), see Phobius details amino acids 539 to 557 (19 residues), see Phobius details amino acids 867 to 886 (20 residues), see Phobius details amino acids 894 to 913 (20 residues), see Phobius details amino acids 920 to 942 (23 residues), see Phobius details amino acids 968 to 988 (21 residues), see Phobius details amino acids 999 to 1022 (24 residues), see Phobius details TIGR00915: RND transporter, hydrophobe/amphiphile efflux-1 (HAE1) family" amino acids 1 to 1030 (1030 residues), 1513.2 bits, see alignment E=0 PF00873: ACR_tran" amino acids 1 to 1021 (1021 residues), 1205.3 bits, see alignment E=0 PF03176: MMPL" amino acids 343 to 513 (171 residues), 36.3 bits, see alignment E=3.3e-13

Best Hits

Swiss-Prot: 51% identical to TTGH_PSEPT: Toluene efflux pump membrane transporter TtgH (ttgH) from Pseudomonas putida (strain DOT-T1E)

KEGG orthology group: K03296, hydrophobic/amphiphilic exporter-1 (mainly G- bacteria), HAE1 family (inferred from 62% identity to atu:Atu3202)

Predicted SEED Role

"RND efflux system, inner membrane transporter CmeB" in subsystem Multidrug Resistance Efflux Pumps or Multidrug efflux pump in Campylobacter jejuni (CmeABC operon)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QQ80 at UniProt or InterPro

Protein Sequence (1032 amino acids)

>PfGW456L13_2954 RND efflux system, inner membrane transporter CmeB (Pseudomonas fluorescens GW456-L13)
MPQFFIDRPVFAWVVALFILLAGALAIPQLPVAQYPDVAPPQIEIYAVYPGASAQTVDES
VVSLIEEELNGTDHLLYFESQSSLGSATIKATFQPGTNPELAQVDVQNRLKAVESRLPQA
VIQQGLQVEKVSSGFLLLITLTSSDGKLDDVALSDYLARNVMNEVKRLDGVGKAQLYGAE
RAMRIWIDPQKLLAFNLTPADVNTAIVAQNAQVSAGSIGDLPTRTTQEITATILVKGQLS
TPEEFADIVLKANPDGSTVRISDVARVEIGSQEYQFSTRLNGKPSTAVAVQLSPGANALN
TATLVRAKMDELKRYFPANVEYSIPYDTSPFVKVSITKVVYTLFEAMLLVFAVMFLFLQN
IRYTLIPTLVVPVALMGTFATMLALGFSINVLTMFGMVLAIGILVDDAIVVVENVERIMA
TEGLSPKEATRKAMQQITGAIIGITLVLVAVFIPMAFMQGSVGVIYQQFSLSMATSILFS
AFLALTLTPALCATLLKPIAKGEHHEKTGFFGWFNRRFEQLTERYQGWVAYALKRTGRYL
LIYGVLLIGLGLAFSRLPSSFLPVEDQGYTITDVQLPPGASKNRTVQVAEQVEAHNAGEP
GIRDSVVILGFSFSGSGQNAALAFSTLKDWSERGSDDSAASIADRANVALSQIKDAVTFA
VLPPPVDGLGTSSGFEFRLQDRGGLGHEKLMQARTELLAAAEKSPILMNVRESALAEAPQ
VQLVVDRKQANALGVSFADVGNVLSTAVGSAYINDFPNQGRMQRVVVQAEGDQRSQVEDL
LKIHVRNTHEKMVPLSAFVQARWTQGPAQLTRYNGYPAISISGEPTPGHSTGEAMAEIER
LVAQGPAGLGQEWTGLSLQERLSGSQAPILLGLSLLIVFLCLAALYESWSIPTSVLLVVP
LGVLGAVLAVTLRGMPNDVFFKVGLITIIGLSAKNAILIIEFAKSLYDDGHDLIDATLQA
ARLRLRPIVMTSLAFILGVVPLAIATGASSASQQAIGTGVIGGMITATLAVVFVPVFFVV
VMKLVRKRHKNI