Protein Info for PfGW456L13_2934 in Pseudomonas fluorescens GW456-L13

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 77 to 101 (25 residues), see Phobius details amino acids 107 to 126 (20 residues), see Phobius details amino acids 133 to 151 (19 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 196 to 216 (21 residues), see Phobius details amino acids 230 to 249 (20 residues), see Phobius details amino acids 261 to 279 (19 residues), see Phobius details amino acids 285 to 302 (18 residues), see Phobius details PF00892: EamA" amino acids 18 to 149 (132 residues), 101.2 bits, see alignment E=5.6e-33 amino acids 165 to 302 (138 residues), 88.9 bits, see alignment E=3.5e-29 PF06027: SLC35F" amino acids 58 to 273 (216 residues), 30.3 bits, see alignment E=3.2e-11

Best Hits

KEGG orthology group: None (inferred from 78% identity to pfo:Pfl01_2918)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293Q142 at UniProt or InterPro

Protein Sequence (314 amino acids)

>PfGW456L13_2934 Permease of the drug/metabolite transporter (DMT) superfamily (Pseudomonas fluorescens GW456-L13)
MTICEQSLSKPSDLPVYLKLAAVTMVWGGTFVAGRYLAAGLSPLLAASLRFLLASVALLL
FIRMARTPLVRPSPRQWLQLSLLGFFGIFFYNLCFFYGLHYINASRASLIVALNPAVIGL
ASWLLFKERLNRAKVVGIAICVAGASMVIVSRDPQLLAGGADVWLGDLLIFGCVLGWGVY
SLFSKELNHTLGPVQTVTYSILLGTVMLWMTCIVRGEVSVAAIAQLGAQQWLSLLYLGVL
GSALAYIGYYDGIRKIGATRSGVFIALNPLTAVILGALLLDEPLTLAMCLGGGLILAGIF
LCNKPLARAWKKGI