Protein Info for PfGW456L13_2929 in Pseudomonas fluorescens GW456-L13

Annotation: Lactoylglutathione lyase (EC 4.4.1.5)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 TIGR00068: lactoylglutathione lyase" amino acids 14 to 170 (157 residues), 162.5 bits, see alignment E=2.4e-52 PF00903: Glyoxalase" amino acids 25 to 167 (143 residues), 90.5 bits, see alignment E=1.1e-29

Best Hits

Swiss-Prot: 81% identical to LGUL_PSEPU: Lactoylglutathione lyase (gloA) from Pseudomonas putida

KEGG orthology group: K01759, lactoylglutathione lyase [EC: 4.4.1.5] (inferred from 94% identity to pba:PSEBR_a3412)

MetaCyc: 81% identical to glyoxalase I monomer (Pseudomonas putida)
Lactoylglutathione lyase. [EC: 4.4.1.5]

Predicted SEED Role

"Lactoylglutathione lyase (EC 4.4.1.5)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 4.4.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.5

Use Curated BLAST to search for 4.4.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QP48 at UniProt or InterPro

Protein Sequence (173 amino acids)

>PfGW456L13_2929 Lactoylglutathione lyase (EC 4.4.1.5) (Pseudomonas fluorescens GW456-L13)
MSLHELNTFPGVTAQPDAATQKFVFNHTMLRVKDITKSLDFYTRILGFTLVEKRDFPEAE
FSLYFLALVDKNQIPADATARTEWMKSIPGILELTHNHGTENDADFAYHNGNTDPRGFGH
ICISVPDIVAACERFEALGCDFQKRLSDGRMKSLAFIKDPDAYWVEIIQPAPL