Protein Info for PfGW456L13_2927 in Pseudomonas fluorescens GW456-L13

Annotation: Alkyl hydroperoxide reductase protein C (EC 1.6.4.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 TIGR03137: peroxiredoxin" amino acids 1 to 187 (187 residues), 348.8 bits, see alignment E=3.4e-109 PF00578: AhpC-TSA" amino acids 6 to 132 (127 residues), 124.5 bits, see alignment E=4.9e-40 PF08534: Redoxin" amino acids 18 to 139 (122 residues), 49 bits, see alignment E=1.2e-16 PF02630: SCO1-SenC" amino acids 23 to 75 (53 residues), 24.8 bits, see alignment E=3.7e-09 PF10417: 1-cysPrx_C" amino acids 155 to 182 (28 residues), 26.3 bits, see alignment 1.1e-09

Best Hits

Swiss-Prot: 70% identical to AHPC_SALTY: Alkyl hydroperoxide reductase C (ahpC) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03386, peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC: 1.11.1.15] (inferred from 95% identity to psb:Psyr_2975)

MetaCyc: 68% identical to alkyl hydroperoxide reductase, AhpC component (Escherichia coli K-12 substr. MG1655)
R4-RXN [EC: 1.11.1.26]

Predicted SEED Role

"Alkyl hydroperoxide reductase protein C (EC 1.6.4.-)" in subsystem Thioredoxin-disulfide reductase (EC 1.6.4.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15, 1.6.4.-

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.26 or 1.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0F4T9H0 at UniProt or InterPro

Protein Sequence (187 amino acids)

>PfGW456L13_2927 Alkyl hydroperoxide reductase protein C (EC 1.6.4.-) (Pseudomonas fluorescens GW456-L13)
MPIINSQVKPFKADAFKNGDFVKVSDADLKGKWSVVFFYPADFTFVCPTELEDLADNYDA
FQKLGVEIYSVSTDTHFAHAAWHNTSPAIGKIQYTMIGDPTHAISRNFDVLIEEAGLADR
GTFVINPEGQIKIVELNDGGVGRDASELLRKIKAAQYVAAHPGQVCPAKWKEGEATLAPS
LDLVGKI