Protein Info for PfGW456L13_2875 in Pseudomonas fluorescens GW456-L13

Annotation: Sigma-54 dependent transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 PF00989: PAS" amino acids 23 to 80 (58 residues), 24.8 bits, see alignment 8.3e-09 PF08448: PAS_4" amino acids 26 to 116 (91 residues), 28.6 bits, see alignment E=6.4e-10 PF00158: Sigma54_activat" amino acids 159 to 326 (168 residues), 226.8 bits, see alignment E=6.1e-71 PF14532: Sigma54_activ_2" amino acids 159 to 330 (172 residues), 81.4 bits, see alignment E=3.5e-26 PF07728: AAA_5" amino acids 181 to 299 (119 residues), 29.6 bits, see alignment E=2.8e-10 PF00004: AAA" amino acids 182 to 312 (131 residues), 22.2 bits, see alignment E=7.5e-08 PF02954: HTH_8" amino acids 425 to 462 (38 residues), 42.1 bits, see alignment 2.6e-14

Best Hits

KEGG orthology group: None (inferred from 91% identity to pfo:Pfl01_3077)

Predicted SEED Role

"Sigma-54 dependent transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QL56 at UniProt or InterPro

Protein Sequence (471 amino acids)

>PfGW456L13_2875 Sigma-54 dependent transcriptional regulator (Pseudomonas fluorescens GW456-L13)
MNTTESLKDYQRVRLLAIRSLFEIIEQSSEGTVIVDRDANIVWMNERYARRFGLQSAEVA
IGKPCESVIPGSLLREVVRTGRPILLDMQDTSKEPLVVMRLPIHDDAGVVIGAIGFALFD
ELRSLSPMLKRYMSMQEELASTRSLLRARQTRYNFAHFIGTSAASLEVKRRARRSASTES
PVLLLGETGTGKELLAQAIHNASPRAHKAFVSINSAAIPESLLEAEFFGTAPGAFTGADR
KGRAGKLQIAQGGTLFLDEIGDMPLPLQSKLLRVLQEKEFEPVGSNEVIQSDVRVIAATS
TDLEAAIKRGEFRADLYYRLNVLPIQVPPLRDRLDDVPALSEAILEELRSQHELHHEALE
LLGQHAWPGNIRELRNVLERAALLSDDLRLTVADIRGAIGTFIPVERVAPLTIEPLAHET
FSVARERFDRQLIETTLAQCGGKVVDAAARLGLGRSTLYKKMVALGIVESQ