Protein Info for PfGW456L13_2865 in Pseudomonas fluorescens GW456-L13

Annotation: Bona fide RidA/YjgF/TdcF/RutC subgroup

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 PF01042: Ribonuc_L-PSP" amino acids 19 to 125 (107 residues), 100 bits, see alignment E=4.7e-33

Best Hits

Swiss-Prot: 43% identical to Y854_PYRHO: RutC family protein PH0854 (PH0854) from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3)

KEGG orthology group: None (inferred from 91% identity to psp:PSPPH_2664)

Predicted SEED Role

"Bona fide RidA/YjgF/TdcF/RutC subgroup"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QR08 at UniProt or InterPro

Protein Sequence (129 amino acids)

>PfGW456L13_2865 Bona fide RidA/YjgF/TdcF/RutC subgroup (Pseudomonas fluorescens GW456-L13)
MSITRYGTGSTAGGGQPRPFARAVEADGWLHVSGQVPALDGEIIVGGIVEQTHQTMKNLI
AILEEAGYGLEDVVRTGVWLEDPRDFWSFNKVFSEYFKPEHAPARACVQANMMVDCKVEI
DCIAYKKKA