Protein Info for PfGW456L13_2832 in Pseudomonas fluorescens GW456-L13

Annotation: sensory box histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 703 PF08448: PAS_4" amino acids 62 to 159 (98 residues), 25 bits, see alignment E=5.5e-09 PF00989: PAS" amino acids 190 to 293 (104 residues), 24.2 bits, see alignment E=8.8e-09 PF08447: PAS_3" amino acids 203 to 289 (87 residues), 58.3 bits, see alignment E=2.3e-19 TIGR00229: PAS domain S-box protein" amino acids 224 to 303 (80 residues), 35.7 bits, see alignment E=4.2e-13 PF02518: HATPase_c" amino acids 444 to 564 (121 residues), 74.6 bits, see alignment E=2.7e-24 PF00072: Response_reg" amino acids 586 to 698 (113 residues), 49.3 bits, see alignment E=1.6e-16

Best Hits

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 82% identity to pfo:Pfl01_3140)

Predicted SEED Role

"sensory box histidine kinase/response regulator"

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QL10 at UniProt or InterPro

Protein Sequence (703 amino acids)

>PfGW456L13_2832 sensory box histidine kinase/response regulator (Pseudomonas fluorescens GW456-L13)
MQFLEESHGCSGWNGEMAGRIRAFDWSRTELGPLDSWSRSLSSAVQLMLASPLPMVMLWG
QSGYMIYNDAYSKFAGGRHPYLLGSAVELGWPEVAEFNRHVVDTCLAGGTLSYRNKELVL
LRDGVPEDVWMDLYYSPVADDDGRPAGVMAMVVETTDRVISEHRRQAAEDAYRADNERVR
LALNAGALLGSFVWDIKANVLSGDERFARAFSYPPGQDLQNLSQEIAESRIHPDDRSWVQ
ERVRLSVETGEPYNVEYRIRRPDGSYLWVLASGCCEFNEQGEAFRFPGVLIDIHERKTAE
ESLLKFTRNLEQRVADEVEARLAAEEQLRQSQKLEAIGGLTGGVAHDFNNLLQVIAGNLH
LLARHEPGNANVQRRVSASIAAVERGAKLSSQLLAFARRQPLSPAVFTLRQIFDGLAELL
LRALGETLQVHMTAPEDSWNVFVDRNQLENAILNLAINARDALQGEGRIDLCAENIVLDR
KFCAAKGIAPGDYVRVSVTDTGVGMPPQVLAQAFEPFFTTKADGQGTGLGLSMVFGFVKQ
SGGHIEIASDVGRGTRVQLYFPRTLRAAPSETPGPDVPQRGGHERILVVEDNEAVRVSAV
ELLREEGYQVLTATNGDVAMQMLLEGLAVDLIFTDVVMPGLIKSSDLAAWAKVQEPPVAV
LFTSGHTRDIISRNHQLSPDTHLLSKPYNPEALTQMVRTVLNG