Protein Info for PfGW456L13_2823 in Pseudomonas fluorescens GW456-L13

Annotation: Flavin reductase-like, FMN-binding

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 PF01613: Flavin_Reduct" amino acids 23 to 172 (150 residues), 85.4 bits, see alignment E=2.2e-28

Best Hits

Swiss-Prot: 42% identical to Y2585_DEIRA: Uncharacterized protein DR_2585 (DR_2585) from Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)

KEGG orthology group: None (inferred from 95% identity to pfo:Pfl01_3148)

MetaCyc: 39% identical to 2-nitrobenzoate nitroreductase subunit (Pseudomonas fluorescens KU-7)
RXN-8847

Predicted SEED Role

"Flavin reductase-like, FMN-binding"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QQW5 at UniProt or InterPro

Protein Sequence (220 amino acids)

>PfGW456L13_2823 Flavin reductase-like, FMN-binding (Pseudomonas fluorescens GW456-L13)
MQSFDFSTLSPRDKYKILIGSVVPRPIALVTTVDGEGRINAAPFSFFNALSADPPILALG
VENYGDQSPKDTTRNIQLNQEFTVNIVSDALVEAMNVCAVPFAPGFDELTAAGLTAIPGT
TVKCPRIGEAPVALECRRMMALSIGQSREIIFGEVLMAHVRDELIDPKTLYIDQLGLDAI
GRMGGHGYARTRDYFDLPTRSLQAWTDAPGGGERFWPATK