Protein Info for PfGW456L13_2817 in Pseudomonas fluorescens GW456-L13

Annotation: HEAT repeat-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 PF13646: HEAT_2" amino acids 15 to 67 (53 residues), 27.9 bits, see alignment 6.9e-10 amino acids 45 to 110 (66 residues), 45.2 bits, see alignment E=2.9e-15 amino acids 110 to 192 (83 residues), 51.5 bits, see alignment E=3.1e-17 amino acids 175 to 244 (70 residues), 54.1 bits, see alignment E=4.9e-18 amino acids 233 to 317 (85 residues), 59.7 bits, see alignment E=8.8e-20 PF02985: HEAT" amino acids 76 to 99 (24 residues), 18.9 bits, see alignment (E = 4.2e-07) amino acids 200 to 226 (27 residues), 18.3 bits, see alignment (E = 6.1e-07) PF00514: Arm" amino acids 163 to 193 (31 residues), 20.3 bits, see alignment (E = 1.4e-07) PF03130: HEAT_PBS" amino acids 184 to 210 (27 residues), 16.1 bits, see alignment (E = 4.2e-06) amino acids 215 to 241 (27 residues), 18.9 bits, see alignment (E = 5.2e-07) amino acids 246 to 270 (25 residues), 13.5 bits, see alignment (E = 2.9e-05) amino acids 277 to 303 (27 residues), 21.8 bits, see alignment (E = 6e-08)

Best Hits

KEGG orthology group: None (inferred from 87% identity to pfo:Pfl01_3158)

Predicted SEED Role

"HEAT repeat-containing protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QNE2 at UniProt or InterPro

Protein Sequence (320 amino acids)

>PfGW456L13_2817 HEAT repeat-containing protein (Pseudomonas fluorescens GW456-L13)
MTSLFDVTDNDDILALQPRLTDDDPGIRRIALIELADLEEPDGLQWLINRLAEDPIADVR
AEAARLLEAWEDEPVVEALCQALTDPSPAVQAAAAQSLSLLKSEAAGPVILPWTGHADSG
VRIATFRALRELRCPDAATAAAAALDDESASVRREAVGVLGWLKQLDALPALARLASADP
DTEVRRAATGALGLASDAQVLPALRQALRDAAWQVREEAATTLGKVGHLDAGPALIDALG
DDYWQVRLRATRSLGRLRYGPALDALIDTLGHRISNLRKEAALALGELSDPRAIAALQAV
QDDGDPEVRKAVRIALSQLQ