Protein Info for PfGW456L13_2802 in Pseudomonas fluorescens GW456-L13

Annotation: Probable transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 51 to 67 (17 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 101 to 119 (19 residues), see Phobius details amino acids 124 to 140 (17 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details PF04632: FUSC" amino acids 24 to 289 (266 residues), 63.7 bits, see alignment E=1.4e-21 PF13515: FUSC_2" amino acids 38 to 164 (127 residues), 51.1 bits, see alignment E=1.5e-17

Best Hits

KEGG orthology group: None (inferred from 88% identity to pfo:Pfl01_2491)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QWH4 at UniProt or InterPro

Protein Sequence (349 amino acids)

>PfGW456L13_2802 Probable transmembrane protein (Pseudomonas fluorescens GW456-L13)
LPPLLRRLLRPLLDPYRRYRHARVIHAVRVSLGLLATILLTTGINLPHGEWASVTMLVVI
GGLQHHGNIGKKAAERAIGTLIGAGVGLVLVAQQAWLGMPWLTYFAMSVVCGFFSYHAIG
KGGYTALLSAITVFIVAGHGDNPVTDGLWRGVDILIGIALALAFSFALPLYAVYSWRYNL
ADALRDCAKVYGRIVDGQAITADEHLKLMTRLNAAMVQLRSLMPSVSKEVKISMTELDAL
QRNLRMCVSTLEILGNTRPDANDLEAMSLMQTALKVEHRQIRVQLIGMARALKSGAAQRL
NRPVDVPLVSLDAPVYNALDGYRLLTQQLAANVGEMRQRLAKSAPRWNI