Protein Info for PfGW456L13_2801 in Pseudomonas fluorescens GW456-L13

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 38 to 59 (22 residues), see Phobius details amino acids 69 to 89 (21 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 126 to 145 (20 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details amino acids 268 to 285 (18 residues), see Phobius details PF00892: EamA" amino acids 15 to 140 (126 residues), 36.3 bits, see alignment E=3.4e-13 amino acids 155 to 282 (128 residues), 61.4 bits, see alignment E=5.9e-21

Best Hits

KEGG orthology group: None (inferred from 90% identity to pfo:Pfl01_2490)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QQU7 at UniProt or InterPro

Protein Sequence (298 amino acids)

>PfGW456L13_2801 Permease of the drug/metabolite transporter (DMT) superfamily (Pseudomonas fluorescens GW456-L13)
MMDKTLRRGSFEMTAAMLISGTIGWFVLVSGQPVLDVVFWRCLFGAGTLLLICAAFGFLR
PGILTRTTFLLAVLSGVAIVGNWVLLFASYSRASIAIGTAVYNVQPFMLVGLAALFLNEK
ITAQKLTWLGVSFLGMLAIVSAHGSQGESGSDYLMGIALALGAALLYAIAALIIKRLTGT
PPHLIALIQVSTGVLLLAPFANLSVLPQAPSAWASLVTLGMVHTGVMYVLLYGAIQKLPT
ALTGALSFIYPIAAIFVDWLAFGHRLEPLQWIGVAAILLAAAGMQQGWSLKFRRTVTP