Protein Info for PfGW456L13_28 in Pseudomonas fluorescens GW456-L13

Annotation: Methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 648 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 293 to 320 (28 residues), see Phobius details PF02743: dCache_1" amino acids 47 to 278 (232 residues), 91.9 bits, see alignment E=9.6e-30 PF22673: MCP-like_PDC_1" amino acids 134 to 200 (67 residues), 28.3 bits, see alignment E=4e-10 PF00672: HAMP" amino acids 315 to 367 (53 residues), 32 bits, see alignment 2.5e-11 PF00015: MCPsignal" amino acids 431 to 612 (182 residues), 140.9 bits, see alignment E=7.8e-45

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 87% identity to pfo:Pfl01_0657)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QD95 at UniProt or InterPro

Protein Sequence (648 amino acids)

>PfGW456L13_28 Methyl-accepting chemotaxis protein (Pseudomonas fluorescens GW456-L13)
MNIKQKLTWAFAIIACLPVVLVATLVVLNLRSDARDEFVDGSAREIRQVSNAMQLFFDGI
SQNVDYLAKQPLIRNSDDSLKTYMAANAESVPQGEADKKVFALLQDLGNSHPAYAYAILG
TAAGGYVSWPDDPKLNNYDPRQRPWYKAAQAKPGKPFRTEAYYWAQDDATYVSTVRTIDN
KLGTNGGVVSIDVTLKQLTEIVKQIKLGETGYLMLLENTGMVLVDPKQPEHNFKPLNSLG
DGYAQLAKAGKGLVEVELNGEHYMANVWPSEQLGWTFIGLIKQDDVMSSATQLTWLIAII
AAVLAVIFAIVGASFASLIVRPIRSVASGLEGIAQGEGDLTQNLQIRGNDETAQLANWFN
QFLTAIRNLIQNIGGAAGKILATSKSSTQVSSDMAEAAGRQREAVDMVSTAFHEMVATAN
EVARSCSQAAESADSGQRQAHEGQQQIDAAVNSVDRLSQEIEQSAQSMQQLERDSNDIQS
ILGTIRSIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRALAKRTADSTAEIDGLLGN
LAKRTSQVTQQMHASLEVSQQSVTRIGEARNSFGQIRESVDVIRDMNTQIATAAEQQHQV
AEDINRHISQIHGDAQLVAELANSARLDSQSLAGLSNELDGLVRRFRT