Protein Info for PfGW456L13_2786 in Pseudomonas fluorescens GW456-L13

Annotation: Phage tail sheath monomer

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF04984: Phage_sheath_1" amino acids 108 to 272 (165 residues), 90.5 bits, see alignment E=1.1e-29 PF17482: Phage_sheath_1C" amino acids 273 to 375 (103 residues), 88.7 bits, see alignment E=2.5e-29

Best Hits

Swiss-Prot: 72% identical to Y807_PSEAB: Putative prophage major tail sheath protein (gpFI) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: K06907, (no description) (inferred from 80% identity to pfl:PFL_2009)

Predicted SEED Role

"Phage tail sheath monomer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QR03 at UniProt or InterPro

Protein Sequence (387 amino acids)

>PfGW456L13_2786 Phage tail sheath monomer (Pseudomonas fluorescens GW456-L13)
MSFFHGVTVTLVDTGARHIATPSASIIGLCNTFTVGPPATAAANELLLITRESEAVAAWG
PDAAITQDCKAIFKRSKAVIVAVGVPLLEDPAEQLSAIIGGVWADGSRTGMQALLNGKSK
FNAQPRLLVTPGYSATLAVATELVALGDKMRAMAILDGPNTTDEAAIAYAENFGSKHAYM
VDPGVQFWDTGTSATVNAPASAWTAGLFAWTDATYGFWASPSNKEFVGITGTTRPIEFLD
GDASCRANVLNNANITTIIRDDGYRLWGNRTLSSDPKWKFVTRVRTLDIVMDAILYAHKW
AVDRSITATYVKDVTEGLQAFMRDLKNQGAIINFEVYADEELNTSSELSDGKVYWNIRFT
DVPPAENPNFRVEVTDQWITEVLDTAA