Protein Info for PfGW456L13_277 in Pseudomonas fluorescens GW456-L13

Annotation: Type IV pilus biogenesis protein PilQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 689 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF11741: AMIN" amino acids 31 to 122 (92 residues), 22 bits, see alignment E=3.6e-08 amino acids 156 to 257 (102 residues), 64.7 bits, see alignment E=1.9e-21 TIGR02515: type IV pilus secretin PilQ" amino acids 271 to 681 (411 residues), 537.5 bits, see alignment E=1.3e-165 PF07660: STN" amino acids 297 to 343 (47 residues), 34.5 bits, see alignment 3.6e-12 PF03958: Secretin_N" amino acids 370 to 436 (67 residues), 48.7 bits, see alignment E=1.8e-16 PF00263: Secretin" amino acids 524 to 680 (157 residues), 172 bits, see alignment E=2.2e-54

Best Hits

KEGG orthology group: K02666, type IV pilus assembly protein PilQ (inferred from 89% identity to pfo:Pfl01_0409)

Predicted SEED Role

"Type IV pilus biogenesis protein PilQ" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QDW0 at UniProt or InterPro

Protein Sequence (689 amino acids)

>PfGW456L13_277 Type IV pilus biogenesis protein PilQ (Pseudomonas fluorescens GW456-L13)
MNRILSTVGLSLWIALLSPMVQAANLKALDVAALPDDRVELKLSFDAPPPVPHGYTTDSP
ARIALDLPGVASQLASKTHDLGSGNARSATVVEARDRTRLIINLTQPAPYDSRIEGNNLL
VVVGQGVKPSTSRPAAAATPVPARAVATAGKAIRGVDFQRGTQGEGNVVIDLSDPSIAPD
IQEREGRIIVGFAKTLLPERLRVRLDVKDFATPVQFVNASASGDRATISIEPGGTFDYST
YQTDNKLTVSVRPATVDELQKRNAGQQAYSGEKLSLNFQDIDVRSVLQLIADFTNLNLVA
SDTVQGGITLRLQNVPWDQALDLVLKTKGLDKRKVGNVLLVAPADEIAARERQELESQKQ
IADLAPLRRELLQVNYAKAADIAKLFQSVTSAEAKPDERGSITVDERTNNIIAYQTQDRL
DELRRIVTQLDIPVRQVMIEARIVEANVDYDKSLGVRWGGSIQNKGNWNTSGVSNGLNGS
STIGTPGSTSTNSPFVDMGVANNTSGIGIAFITDNVLLDLELTAMEKTGNGEIVSQPKVV
TSDKETAKILKGTEIPYQEASSSGATSVSFKEASLSLEVTPQITPDNRIIMEVKVTKDEP
DYLNKVQDVPPIKKNEVNAKVLVNDGETIVIGGVFSNTQSKVVDKVPFLGDVPYLGRLFR
RDVVSEKKSELLVFLTPRIMNNRAIAVSH