Protein Info for PfGW456L13_2742 in Pseudomonas fluorescens GW456-L13

Annotation: benABC operon transcriptional activator BenR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF14525: AraC_binding_2" amino acids 26 to 203 (178 residues), 103.6 bits, see alignment E=1.6e-33 PF00165: HTH_AraC" amino acids 237 to 278 (42 residues), 31.5 bits, see alignment 2.2e-11 PF12833: HTH_18" amino acids 251 to 330 (80 residues), 67.6 bits, see alignment E=1.5e-22

Best Hits

KEGG orthology group: None (inferred from 52% identity to bgl:bglu_2g21200)

Predicted SEED Role

"benABC operon transcriptional activator BenR" in subsystem Benzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QQ46 at UniProt or InterPro

Protein Sequence (335 amino acids)

>PfGW456L13_2742 benABC operon transcriptional activator BenR (Pseudomonas fluorescens GW456-L13)
MNLQTHAGTDVEFQDIHAVRHDLQSAQAWMSNICGPHELKASCPQRMHFQHAGNVLKSMS
TVIGYIEYGTDVTIDIDASVLNSYSISLPISGEQELRKSNGLLMSDSDNGLIVSPYDQQE
LSITGNCRKIQVAIKCAAMRQVLEELLQRPAQQPIVFETRVGASEGAPAAWWRLVKYLLT
EMEQARNFFGHISMARDIEKALIKGFILSQPNNYSDELVGLSQSRCPEYLFKAKQFIHEH
ACDEVDLDELGRAVGVSRFKLYEDFKKYFGLTPTLYLKRFRLEAVRQALLEGGSNENITA
VAMRWGFNHLGRFSSDYKKMFLEVPSKTVERSRKL