Protein Info for PfGW456L13_2739 in Pseudomonas fluorescens GW456-L13

Updated annotation (from data): Anthranilate 1,2-dioxygenase (deaminating, decarboxylating) (EC 1.14.12.1)
Rationale: Specifically important for utilizing L-Tryptophan. Automated validation from mutant phenotype: the predicted function (1.14.12.1-RXN) was linked to the condition via a MetaCyc pathway. This annotation was also checked manually.
Original annotation: Benzoate 1,2-dioxygenase beta subunit (EC 1.14.12.10)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 162 PF13577: SnoaL_4" amino acids 7 to 143 (137 residues), 30.5 bits, see alignment E=3.4e-11 TIGR03231: anthranilate 1,2-dioxygenase, small subunit" amino acids 8 to 162 (155 residues), 284.9 bits, see alignment E=9e-90 PF00866: Ring_hydroxyl_B" amino acids 14 to 155 (142 residues), 167.4 bits, see alignment E=2.2e-53

Best Hits

Swiss-Prot: 60% identical to ANTDB_ACIAD: Anthranilate 1,2-dioxygenase small subunit (antB) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)

KEGG orthology group: K05600, anthranilate 1,2-dioxygenase (deaminating, decarboxylating) small subunit [EC: 1.14.12.1] (inferred from 77% identity to pfs:PFLU5195)

MetaCyc: 60% identical to anthranilate dioxygenase oxygenase component small subunit (Acinetobacter)
Anthranilate 1,2-dioxygenase (deaminating, decarboxylating). [EC: 1.14.12.1]

Predicted SEED Role

"Benzoate 1,2-dioxygenase beta subunit (EC 1.14.12.10)" in subsystem Benzoate degradation (EC 1.14.12.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.12.1, 1.14.12.10

Use Curated BLAST to search for 1.14.12.1 or 1.14.12.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QN62 at UniProt or InterPro

Protein Sequence (162 amino acids)

>PfGW456L13_2739 Anthranilate 1,2-dioxygenase (deaminating, decarboxylating) (EC 1.14.12.1) (Pseudomonas fluorescens GW456-L13)
MSALQYSIEQFLYRKAELCDQQDWDAYITLFDEQSEFHLPQWESEHVYTTDPKRSMSLIY
YSNRSGLEDRVFRLRTGKSAASTPMPRTLHQISNVRINELNNGLLEVKAAWVTLFTRQGL
SEQFYGHVTYHLRPVADSWKITRKHIVLLNDTINSVLDFYHL