Protein Info for PfGW456L13_2693 in Pseudomonas fluorescens GW456-L13

Annotation: acetyltransferase, GNAT family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF00583: Acetyltransf_1" amino acids 19 to 136 (118 residues), 64 bits, see alignment E=4e-21 PF13302: Acetyltransf_3" amino acids 23 to 136 (114 residues), 33.8 bits, see alignment E=1.3e-11 PF13673: Acetyltransf_10" amino acids 41 to 138 (98 residues), 35.9 bits, see alignment E=1.7e-12 PF13508: Acetyltransf_7" amino acids 49 to 137 (89 residues), 50 bits, see alignment E=8.3e-17

Best Hits

Swiss-Prot: 44% identical to YHFO_BACSU: Uncharacterized N-acetyltransferase YhfO (yhfO) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 73% identity to pfo:Pfl01_3561)

Predicted SEED Role

"acetyltransferase, GNAT family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QQ01 at UniProt or InterPro

Protein Sequence (152 amino acids)

>PfGW456L13_2693 acetyltransferase, GNAT family (Pseudomonas fluorescens GW456-L13)
MAIQALRADASHIDQIAPLFDAYRMFYQQPSNLSQSRAFIAERLARDESVIFLARDSDGE
NLGFVQLFPTFSSIDAHRTWLLGDLFTTPAARGKGVGTLLMNTARDFAKLAGGKGMTLET
ATDNVTAQRLYESLGWVRDPGYYTYCLDLQKG