Protein Info for PfGW456L13_268 in Pseudomonas fluorescens GW456-L13

Annotation: Cytochrome B561

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 transmembrane" amino acids 16 to 39 (24 residues), see Phobius details amino acids 49 to 72 (24 residues), see Phobius details amino acids 85 to 112 (28 residues), see Phobius details amino acids 133 to 161 (29 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 11 to 173 (163 residues), 62.6 bits, see alignment E=2.2e-21

Best Hits

KEGG orthology group: None (inferred from 44% identity to yen:YE3562)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QIY7 at UniProt or InterPro

Protein Sequence (187 amino acids)

>PfGW456L13_268 Cytochrome B561 (Pseudomonas fluorescens GW456-L13)
LIELKMTVSGYSRQRVLLHWLSAAVILWTLLSGFLVAGFEVSAHIKESVAFFNVSLTTVF
IPFYLWRLFLFFTHTRFSGMKSLSLVEVLALFAHALIYLFVGAVLVTGVLMMDRPIDVFG
VIEIGQPLSDPQLIALFVTVHTWVCVVLSLLLVAHIGAVIVHEACNHRVLQRMSLRLCGK
PGSGRLE