Protein Info for PfGW456L13_266 in Pseudomonas fluorescens GW456-L13

Annotation: General secretion pathway protein D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 639 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF21305: type_II_gspD_N0" amino acids 38 to 103 (66 residues), 61.4 bits, see alignment E=9.2e-21 TIGR02517: type II secretion system protein D" amino acids 39 to 592 (554 residues), 487.2 bits, see alignment E=3.6e-150 PF03958: Secretin_N" amino acids 131 to 190 (60 residues), 37.5 bits, see alignment 3.5e-13 amino acids 196 to 258 (63 residues), 42.2 bits, see alignment E=1.2e-14 amino acids 266 to 343 (78 residues), 63.3 bits, see alignment E=3.1e-21 PF00263: Secretin" amino acids 416 to 583 (168 residues), 160.1 bits, see alignment E=6e-51

Best Hits

Predicted SEED Role

"General secretion pathway protein D"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QDU9 at UniProt or InterPro

Protein Sequence (639 amino acids)

>PfGW456L13_266 General secretion pathway protein D (Pseudomonas fluorescens GW456-L13)
MNSFLGARALRPVLFFAAMALTLSHGTLQAEEEKWQLAMNNAELRDIVEEISNILGTTVV
LDPKVSGRITVMSRQALDREGVRRLFYSVLDAHNFTVIDEGDRILITPVAEAKTRAGQGT
VKTTTASQFVTEVIALNTGSATDIAGLVRPLVSANGYVGPSVSANALVLTDTAANVKRIA
RVIRELDSGQNNLHVVVQLKHALAGDVAPVIEASMGKRNAESAIQVLADTRTNRLIFIGP
PVVRQRLIELARGLDTPATTTLDNARVIRLRHSDAKQLAEILESMGQGRKQTSAVGSAKD
TSGGAAFMIKADESQNALVLIAEPAQVRTIENIVRQLDQPRAQVLIHAAIVEISGDIAEA
VGVQWNLNTGDAKGFINFPGTDIPIIGGLKFDEKRSAPEGAILQLGGDRFGALVSALASN
THSNLLSTPSLLTLDNQEAEIIVGQNVPFKTGSYATNSNGAENPFTTVERKDVGISLKIK
PYINEGSTLRLEVEQEVSDIAPSVSGIDSSDLITNKRALKSTILADDGEIIVIGGLIRDS
VRTQKSGVPLLRDIPYLGAIFRWSRDTQTKSNLMVFLRPTIVRSKEDLSQVSQQRYNALR
DLSKSGAGENNSLLLPSEARGLFEPATDAPVFDLRGKAQ