Protein Info for PfGW456L13_2652 in Pseudomonas fluorescens GW456-L13

Annotation: Outer membrane lipoprotein carrier protein LolA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details TIGR00547: outer membrane lipoprotein carrier protein LolA" amino acids 13 to 204 (192 residues), 89.3 bits, see alignment E=1.2e-29 PF03548: LolA" amino acids 35 to 197 (163 residues), 190 bits, see alignment E=2.7e-60

Best Hits

Swiss-Prot: 90% identical to LOLA_PSEF5: Outer-membrane lipoprotein carrier protein (lolA) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K03634, outer membrane lipoprotein carrier protein (inferred from 91% identity to pfo:Pfl01_3585)

Predicted SEED Role

"Outer membrane lipoprotein carrier protein LolA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0F4TZI2 at UniProt or InterPro

Protein Sequence (207 amino acids)

>PfGW456L13_2652 Outer membrane lipoprotein carrier protein LolA (Pseudomonas fluorescens GW456-L13)
MRLIRMLLLPVLALTTLQANADDKDVARLTQLLEKSQTLTARFSQLTLDGTGTQLQETAG
EMSLQRPGLFYWHTDAPAEQTMISDGKKVTLWDPDLEQATIKNLDQRLTQTPALLLSGDV
SKISQSFDISAKEAGGVIDFTLKPKTKDTLFDSLRLSFRNGLVNDMQLIDSVGQRTNILF
TGVKANEPIPASKFKFDIPKGADVIQE