Protein Info for PfGW456L13_2644 in Pseudomonas fluorescens GW456-L13

Annotation: Cold shock protein CspD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 88 PF00313: CSD" amino acids 7 to 68 (62 residues), 94.7 bits, see alignment E=1.2e-31 TIGR02381: cold shock domain protein CspD" amino acids 7 to 68 (62 residues), 121.9 bits, see alignment E=3.9e-40

Best Hits

Swiss-Prot: 64% identical to CSPD_ECOL6: Cold shock-like protein CspD (cspD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03704, cold shock protein (beta-ribbon, CspA family) (inferred from 80% identity to ppg:PputGB1_3615)

Predicted SEED Role

"Cold shock protein CspD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QQ68 at UniProt or InterPro

Protein Sequence (88 amino acids)

>PfGW456L13_2644 Cold shock protein CspD (Pseudomonas fluorescens GW456-L13)
MSGGKVSGKVKWFNNAKGYGFINEDGKTEDLFAHYSAIQMEGYKTLKAGQAVVFDIIQGP
KGLHAVNIGSPVGASKATASAPQQTVTV