Protein Info for PfGW456L13_2578 in Pseudomonas fluorescens GW456-L13

Annotation: serine/threonine protein kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 437 PF00560: LRR_1" amino acids 37 to 58 (22 residues), 11.4 bits, see alignment (E = 9.8e-05) PF13855: LRR_8" amino acids 127 to 185 (59 residues), 27.3 bits, see alignment E=7.7e-10 PF07714: PK_Tyr_Ser-Thr" amino acids 205 to 371 (167 residues), 53.6 bits, see alignment E=6.5e-18 PF00069: Pkinase" amino acids 206 to 370 (165 residues), 50.6 bits, see alignment E=5.5e-17 PF06293: Kdo" amino acids 293 to 361 (69 residues), 26.5 bits, see alignment E=1.2e-09

Best Hits

KEGG orthology group: None (inferred from 81% identity to pfo:Pfl01_3676)

Predicted SEED Role

"serine/threonine protein kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QPP0 at UniProt or InterPro

Protein Sequence (437 amino acids)

>PfGW456L13_2578 serine/threonine protein kinase (Pseudomonas fluorescens GW456-L13)
MHTLAQLRAGELSGITRLDLAEGLTEFPREIFDLADSLEVLNLSGNALSALPEDLHRLSR
LRVLFCSDNRFTELPACVGQCAALTMIGFKANRIAHVPAAALPPLLRWLILTDNCIETLP
SALGERPYLQKLMLAGNRLQALPESMHNCHRLELIRIAANQFTDLPQWLLTLPSLTWLAY
AGNPLETEADAAALNATPRIDWSALHLEKKLGEGASGVIHQAVWQPTDQPAMPVAVKLYK
GEMTSDGSPLHEMNACITAGLHPNLIRVEGRIVDHPQQTAGLAMQLVPPSFRNLASLPSL
ASCSRDIYAEGLRFSAAVALRIASGIASVAEHLHNHGITHGDLYGHNILWNEQGDCLLGD
FGAASFHGISDSLESRALQRIEVRAFGVLLGELLERVNSGLSDEQRGVLEDLEQRCCQPQ
VLLRPGFSEIVRQLESL