Protein Info for PfGW456L13_2561 in Pseudomonas fluorescens GW456-L13

Annotation: ABC exporter for hemopore HasA, membrane fusion protein (MFP) family component HasE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 28 to 47 (20 residues), see Phobius details TIGR01843: type I secretion membrane fusion protein, HlyD family" amino acids 25 to 446 (422 residues), 380.1 bits, see alignment E=7.2e-118 PF00529: CusB_dom_1" amino acids 37 to 400 (364 residues), 31.7 bits, see alignment E=1.8e-11 PF13437: HlyD_3" amino acids 297 to 391 (95 residues), 44.7 bits, see alignment E=2.8e-15

Best Hits

KEGG orthology group: K12537, protease secretion protein HasE (inferred from 86% identity to ppu:PP_2559)

Predicted SEED Role

"ABC exporter for hemopore HasA, membrane fusion protein (MFP) family component HasE" in subsystem Protein secretion by ABC-type exporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QK82 at UniProt or InterPro

Protein Sequence (446 amino acids)

>PfGW456L13_2561 ABC exporter for hemopore HasA, membrane fusion protein (MFP) family component HasE (Pseudomonas fluorescens GW456-L13)
MQMSQHTEMITADPRSVVDLDVGKPARWGVWLVLAGFGGFLLWSWLAPLDAGVVATGTVK
VTSNRKAVQHLSGGTVEAILVREGDLVTKGQEVVRLDSLRAAAEQGAVSAQYIVSKTVEN
RLEAERDNRDVVNFDPELLKRFKDDHRLEAAMDLQQRLLDTRRAGLAGEISILQENLAAS
AVQLKGLQQVYSARASQISFLNQELQGTRVLTAEGYVPRNRLLELERSNADLAAGQAENL
NNIARVRSQTTEIKLRILQRQHDYLKEVESQLTETAKENTTLADRLRALDYEVTHTVIRS
PIDGMVQALSIATVGGIIQPGFKIMEIVPVNEPLQVDAMIPVQAIDKMFPGLPVDISFPA
FNHAQTPNIPGRVMTISADRLMDEESKQPFYLAQVEVTPDGMSLLGTNHIRPGMPASVTI
KTGERNMLSYLLKPMLERVDSSFKEQ