Protein Info for PfGW456L13_2530 in Pseudomonas fluorescens GW456-L13

Annotation: 2,3-dihydroxybiphenyl 1,2-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 PF00903: Glyoxalase" amino acids 144 to 266 (123 residues), 66.4 bits, see alignment E=1.6e-22

Best Hits

Swiss-Prot: 44% identical to BPHC_PSEPS: Biphenyl-2,3-diol 1,2-dioxygenase (bphC) from Pseudomonas pseudoalcaligenes

KEGG orthology group: K00462, biphenyl-2,3-diol 1,2-dioxygenase [EC: 1.13.11.39] (inferred from 59% identity to gpb:HDN1F_27360)

MetaCyc: 56% identical to 3,4-dihydroxy-9,10-secoandrosta-1,3,5(10)-triene-9,17-dione 4,5-dioxygenase (Comamonas testosteroni)
dioxygenase. [EC: 1.13.11.25]

Predicted SEED Role

"2,3-dihydroxybiphenyl 1,2-dioxygenase" in subsystem Biphenyl Degradation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.13.11.39

Use Curated BLAST to search for 1.13.11.25 or 1.13.11.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QK69 at UniProt or InterPro

Protein Sequence (298 amino acids)

>PfGW456L13_2530 2,3-dihydroxybiphenyl 1,2-dioxygenase (Pseudomonas fluorescens GW456-L13)
MDIRGLGYVTLLSSDLAQWRHYASQVLGMMVIGSDDDAHLYLKMDERHYRILVQKNVENG
FGACGWEVAGKAALEQAVSELQQADVQVTRGTAAEAELRKVQELVHFSDPDGNRHEIFWG
PLQDFARFVSPVGVKGFVTNELGMGHVVLPAPAFERCRDFYEQVLGFGLSDLMKVRFTPD
PAEPQKRIHFLHCNNGRHHSLAIFECPMPHGCVHMMVEVNALDEVGRALDRVHANGVKLS
ATLGQHTNDQMISFYIKTPSGFDLEYGCDGLVVDWDRHTPFESTVVSHWGHDFSVGRQ