Protein Info for PfGW456L13_2526 in Pseudomonas fluorescens GW456-L13
Annotation: 4-hydroxyphenylacetate 3-monooxygenase, reductase component (EC 1.6.8.-)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 37% identical to RUTF_PSE14: FMN reductase (NADH) RutF (rutF) from Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6)
KEGG orthology group: None (inferred from 58% identity to bcj:BCAM1645)MetaCyc: 36% identical to FMN reductase RutF (Escherichia coli K-12 substr. MG1655)
RXN-9510 [EC: 1.5.1.42]
Predicted SEED Role
"4-hydroxyphenylacetate 3-monooxygenase, reductase component (EC 1.6.8.-)" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway or Aromatic Amin Catabolism (EC 1.6.8.-)
MetaCyc Pathways
- bacterial bioluminescence (4/8 steps found)
- dibenzothiophene desulfurization (1/5 steps found)
Isozymes
Compare fitness of predicted isozymes for: 1.6.8.-
Use Curated BLAST to search for 1.5.1.42 or 1.6.8.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A293QQ92 at UniProt or InterPro
Protein Sequence (171 amino acids)
>PfGW456L13_2526 4-hydroxyphenylacetate 3-monooxygenase, reductase component (EC 1.6.8.-) (Pseudomonas fluorescens GW456-L13) MNDVNLKADMLQAMRRLAKSVTIISTSNGTERFAMAATAVDSLSTEPPSLLICVNKTASP HAALATGADFCVNILGVEQQDLANLCSGAIKGEARFDRGNWLTSPGGIPYLGDAQSAILC RQDGHFSYGTHTVFIGRILQIHTTAEITPLVYLDGSYTTTAKPAPSLAAAG