Protein Info for PfGW456L13_2512 in Pseudomonas fluorescens GW456-L13

Annotation: Esterase/lipase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 PF20434: BD-FAE" amino acids 66 to 167 (102 residues), 72.6 bits, see alignment E=6.9e-24 PF00135: COesterase" amino acids 66 to 163 (98 residues), 33.1 bits, see alignment E=6.7e-12 PF07859: Abhydrolase_3" amino acids 77 to 283 (207 residues), 274.6 bits, see alignment E=1.2e-85

Best Hits

Swiss-Prot: 41% identical to NLHH_MYCTU: Carboxylesterase NlhH (nlhH) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 52% identity to reu:Reut_A1537)

Predicted SEED Role

"Esterase/lipase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293PZY5 at UniProt or InterPro

Protein Sequence (308 amino acids)

>PfGW456L13_2512 Esterase/lipase (Pseudomonas fluorescens GW456-L13)
MPLDKQIAGVLQQFRDIPEPDFSQVDAAQYRQFSDNLLPAIPGDPMSEVRDLRVAGADGE
LDARLYRPSEEPDLPLLVFFHGGGFVMGNLDTHDNLCRSLARQTEAVVVSVAYRLAPESK
FPAAPLDCYAATCWLVEHAAELRVDGSRLAVAGDSAGGNLALAVSQLAARRQGPKISYQC
LFYPVTDAGCDSQSFEDFAESYLLSAAMMRWFWQQYLQDVGQADDPLASPLRAESLAGLP
PTTLMTAEFDPLRDEGEAMAECLREAGVPVRVQRCDGMIHGFISMAPFVEGAAHALTDAA
ADLRGALK