Protein Info for PfGW456L13_2497 in Pseudomonas fluorescens GW456-L13

Annotation: Acyl dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF01575: MaoC_dehydratas" amino acids 14 to 130 (117 residues), 82.7 bits, see alignment E=8.2e-28

Best Hits

Swiss-Prot: 49% identical to ECH1_MYCTU: Probable enoyl-CoA hydratase 1 (Rv0130) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: None (inferred from 73% identity to gpb:HDN1F_02500)

MetaCyc: 47% identical to 4-chloro-3-hydroxybutyryl-CoA dehydratase (Salinispora tropica)
4.2.1.-

Predicted SEED Role

"Acyl dehydratase"

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QK41 at UniProt or InterPro

Protein Sequence (152 amino acids)

>PfGW456L13_2497 Acyl dehydratase (Pseudomonas fluorescens GW456-L13)
MPRIFDTPMALFDAVGQELGVSEWLLLGQDRINLFADATGDHQWIHVDPLKAANGPFGAC
IAHGYLSLSLVNLFLPQIVEVRGLAMGVNYGCERVRFPSVVRVGSRVRGSAQLIAVEEVK
GGVQATIRVSVEIDGEERPGCVVDTISRYYPA