Protein Info for PfGW456L13_2468 in Pseudomonas fluorescens GW456-L13

Annotation: Putative outer membrane lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF07759: DUF1615" amino acids 46 to 360 (315 residues), 486.5 bits, see alignment E=1.9e-150

Best Hits

Swiss-Prot: 61% identical to YAIW_ECOLI: Uncharacterized protein YaiW (yaiW) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 83% identity to pfo:Pfl01_3749)

Predicted SEED Role

"Putative outer membrane lipoprotein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QPP6 at UniProt or InterPro

Protein Sequence (363 amino acids)

>PfGW456L13_2468 Putative outer membrane lipoprotein (Pseudomonas fluorescens GW456-L13)
MQIRLITSVAVLLVLTGCGSQRTQEPVARSPAEVKAEIVRLLPAKAADRQGWATDIQVAF
TAQDISPTTQNLCSVLAVTEQESTFQVDPSVPGLGKIARDEIDRRAAKAHIPGLLVSGAL
MLDSPNGKSYSSRLNAARSEKELSAVFDDFIGMVPMGKTLFGGFNPVHTGGPMQVSIDFA
EQQAKGYPYPVKGSIRREVFTRRGGMYFGIAHLLGYPVSYPQPLYRFADFNAGWYASRNA
AFQNAVSRASGISLALDGDLVRYGSIMPGTTELAVRTLGKQLDMRNPTIRAQLEEGNTLA
FEDSKLYRRVFELAERAEGRPLPRQVLPGIVLQSPKITRKLTTAWFAKRVDERYQRCMAR
AGQ