Protein Info for PfGW456L13_2432 in Pseudomonas fluorescens GW456-L13

Annotation: 3-hydroxyacyl-CoA dehydrogenase PaaC (EC 1.1.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02279: 3-hydroxyacyl-CoA dehydrogenase PaaC
  • amino acids 4 to 505 (502 residues), 794.8 bits, E=1.7e-243
• PF03446: NAD_binding_2
  • amino acids 9 to 125 (117 residues), 23.5 bits, E=1.3e-08
• PF02558: ApbA
  • amino acids 10 to 91 (82 residues), 22.2 bits, E=2.3e-08
• PF02737: 3HCDH_N
  • amino acids 10 to 186 (177 residues), 206.2 bits, E=1e-64
• PF00725: 3HCDH
  • amino acids 190 to 287 (98 residues), 95.8 bits, E=4.5e-31
  • amino acids 420 to 501 (82 residues), 62.5 bits, E=1.1e-20
• PF18321: 3HCDH_RFF
  • amino acids 347 to 416 (70 residues), 69.7 bits, E=5.4e-23

Best Hits

KEGG orthology group: K00074, 3-hydroxybutyryl-CoA dehydrogenase [EC: 1.1.1.157] (inferred from 72% identity to pmk:MDS_2863)

Predicted SEED Role

"3-hydroxyacyl-CoA dehydrogenase PaaC (EC 1.1.1.-)" (EC 1.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-, 1.1.1.157

Use Curated BLAST to search for 1.1.1.- or 1.1.1.157

Sequence Analysis Tools

See A0A293QM98 at UniProt or InterPro

Protein Sequence (505 amino acids)

>PfGW456L13_2432 3-hydroxyacyl-CoA dehydrogenase PaaC (EC 1.1.1.-) (Pseudomonas fluorescens GW456-L13)
MTALNTSARIAVIGAGAMGAGIAQVAAQAGHPVLLLDNRPGAAAQAIEGIDRQLGKRVEN
GKLSAESRSATVARLQAVEVIETLADCDLIIEAIVENLEVKRALFRQLEGICGEHCILAS
NTSSLSITSIAAQLDHPQRLLGLHFFNPAPVMALVEVVSGLASDPALAECLYDTARAWGK
KPVHTRSTPGFIVNRVARPFYAESLRMLQEGAADCPTLDALMREAGGFAMGAFELTDLIG
HDVNYAVTCSVFDAYYQDTRFLPSLIQKELVDGGRLGRKSGQGFYCYAQGAERPQAGEIS
SSASVETCIAEGDLGIAQGLLARLSEQGVEVIRRDGRGLLRVGDAVLALSDGRMACQRAR
EDGLRNLILLDLAFDYGNAKRIAISHAAGIDPLALEQGVALLQRAGLMVSLLSDSPALAV
LRTVAMLANEAADALLQGVASAADIDLAMRAGVNYPQGPLAWADAIGLSHILETLENLQA
SYGEERYRPSLLLRRRVAEGRTFHD