Protein Info for PfGW456L13_2425 in Pseudomonas fluorescens GW456-L13

Annotation: Phenylacetate-CoA oxygenase, PaaI subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF05138: PaaA_PaaC" amino acids 3 to 253 (251 residues), 295.6 bits, see alignment E=1.5e-92 TIGR02158: phenylacetate-CoA oxygenase, PaaI subunit" amino acids 14 to 253 (240 residues), 272.3 bits, see alignment E=2.2e-85

Best Hits

Swiss-Prot: 52% identical to PAAC_ECOLI: 1,2-phenylacetyl-CoA epoxidase, subunit C (paaC) from Escherichia coli (strain K12)

KEGG orthology group: K02611, phenylacetic acid degradation protein (inferred from 78% identity to pfl:PFL_3135)

MetaCyc: 78% identical to ring 1,2-phenylacetyl-CoA epoxidase PaaC subunit (Pseudomonas sp. Y2)
RXN0-2042 [EC: 1.14.13.149]

Predicted SEED Role

"Phenylacetate-CoA oxygenase, PaaI subunit"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.149

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QJY0 at UniProt or InterPro

Protein Sequence (253 amino acids)

>PfGW456L13_2425 Phenylacetate-CoA oxygenase, PaaI subunit (Pseudomonas fluorescens GW456-L13)
MNNKTDLIEYLLRLGDSALIQGQRLCQWCGKAPALEEELALMNVGLDLVGQARNWLEYAA
ELLDDGRDADHLAFRRDERAYRNLLLVEQPNGDFAITMLKQFLYDAWHLPVLQGLSQSSD
ERIAGIAAKAVKEVTYHLRRSGEWIERMGDGTEESNRRMLAAIPEVWRFTVELIAADDSE
QRLCAAGITPDIASVATQWQTKVEQIFTSATLPVPAAPSYFYLNARKGLHTEHLGILLAE
MQCLPRAYPDATW