Protein Info for PfGW456L13_2413 in Pseudomonas fluorescens GW456-L13

Annotation: Putrescine ABC transporter putrescine-binding protein PotF (TC 3.A.1.11.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13416: SBP_bac_8" amino acids 45 to 333 (289 residues), 131.1 bits, see alignment E=1.1e-41 PF01547: SBP_bac_1" amino acids 45 to 303 (259 residues), 67.3 bits, see alignment E=3.7e-22 PF13343: SBP_bac_6" amino acids 79 to 318 (240 residues), 62 bits, see alignment E=9.1e-21

Best Hits

Swiss-Prot: 48% identical to POTF_ECOLI: Putrescine-binding periplasmic protein (potF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 76% identity to ppg:PputGB1_2188)

MetaCyc: 48% identical to putrescine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Putrescine ABC transporter putrescine-binding protein PotF (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QJX2 at UniProt or InterPro

Protein Sequence (368 amino acids)

>PfGW456L13_2413 Putrescine ABC transporter putrescine-binding protein PotF (TC 3.A.1.11.2) (Pseudomonas fluorescens GW456-L13)
MGKTLLKVISSLFVVPLTLNAYAAQVDDSHTLRLYNWADYIGEKTVADFEKATGIKVIYD
TFDAYETVQAKLLTGHSGYDLIVLNASLAPPLIKAKVFQPLDKKLLPGWTNLDPKVLEDL
QGYDPGTTYSAPYTWGSNGVTYNVDKIKERMPDAPIGSLAMIFDPKIVSRFADCGVTLLD
APTEVIPMALKYLGRDPRSAAPEDLKAAQDLLLSVRPYIRKFDSVNYLTSLPNGDVCMAM
TWSGDYATAMARAAEAKKKIDLAYFIPKEGSLIWFDNLYIPADAPHVANAHKFLEYLMQP
QVMADVSDFINYANSNAAATPLLSADVRNNPAIYPDAQTRERLFPQKTQNAKDMRAITRV
WSTVKSGI