Protein Info for PfGW456L13_2386 in Pseudomonas fluorescens GW456-L13

Annotation: PvdO, pyoverdine responsive serine/threonine kinase (predicted by OlgaV)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF03781: FGE-sulfatase" amino acids 48 to 293 (246 residues), 195 bits, see alignment E=9.7e-62

Best Hits

KEGG orthology group: None (inferred from 79% identity to pfs:PFLU2548)

MetaCyc: 69% identical to dihydropyoverdine dehydrogenase (Pseudomonas aeruginosa PAO1)
RXN-20771

Predicted SEED Role

"PvdO, pyoverdine responsive serine/threonine kinase (predicted by OlgaV)" in subsystem Siderophore Pyoverdine

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QNL2 at UniProt or InterPro

Protein Sequence (295 amino acids)

>PfGW456L13_2386 PvdO, pyoverdine responsive serine/threonine kinase (predicted by OlgaV) (Pseudomonas fluorescens GW456-L13)
MKNILNRGRSKGLGALMLLALLGSAMPGLAQAYTAPLPGKVFKDCRNCPEMVVLPAGTFT
MGTPEDEVGREPDEGPMHEVTFDKPFAMSRYQITAGEWDQYLKETGITLPDGDTRPGREC
INSKPRYPQSPRQPAVCMNFAEVSAYVAWLSMKTGQHYHIVSEAQREYAARAGATGPFPF
PFDPGTEYSIATHANTYGPTDGYSYSSPVGSYPPNAFGMYDMHGNVYEWIADCYHPDYVG
APTDGSAWTEPNCDTLRIRGNDWGEAPVFSRSGNRNDIDPQTRGDWIGFRVVRTL