Protein Info for PfGW456L13_2369 in Pseudomonas fluorescens GW456-L13

Annotation: Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 PF01965: DJ-1_PfpI" amino acids 3 to 176 (174 residues), 62.2 bits, see alignment E=8.1e-21 PF12833: HTH_18" amino acids 236 to 315 (80 residues), 75.5 bits, see alignment E=5e-25 PF00165: HTH_AraC" amino acids 277 to 313 (37 residues), 31.7 bits, see alignment 2e-11

Best Hits

KEGG orthology group: None (inferred from 89% identity to pfo:Pfl01_1836)

Predicted SEED Role

"Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QMM0 at UniProt or InterPro

Protein Sequence (327 amino acids)

>PfGW456L13_2369 Transcriptional regulator containing an amidase domain and an AraC-type DNA-binding HTH domain (Pseudomonas fluorescens GW456-L13)
MSKTIHVLAFANVQILDVTGPLQVFASANDIARQQGLPPPYAPTVIASGGGAVMSSAGLA
LLAEPLPDEGTDTLIIAGGWGVYAAAQDAPLVAWVREHARGCRRVSSVCTGAFLLAASGW
LDGRRVVTHWTRCEQLAQQHPQLHVEPNPIFINDGPVWTSAGVTAGIDLALAMVEEDLGR
TMALEVARQLVVFLKRPGGQSQFSVTLSLQQEGNRFDELHAWISENLAHDLGIPTLALQA
GMSERSFVRHYRADTGQTPARAIELIRVETARRLLSDTGVPIKRVAVQCGFGSEETLRRS
FLRAMGVTPQAYRERFSVSVGADSMVP