Protein Info for PfGW456L13_235 in Pseudomonas fluorescens GW456-L13

Annotation: FIG018329: 1-acyl-sn-glycerol-3-phosphate acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details PF01553: Acyltransferase" amino acids 83 to 200 (118 residues), 50.6 bits, see alignment E=8.9e-18

Best Hits

KEGG orthology group: None (inferred from 84% identity to pba:PSEBR_a458)

Predicted SEED Role

"FIG018329: 1-acyl-sn-glycerol-3-phosphate acyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QIF8 at UniProt or InterPro

Protein Sequence (270 amino acids)

>PfGW456L13_235 FIG018329: 1-acyl-sn-glycerol-3-phosphate acyltransferase (Pseudomonas fluorescens GW456-L13)
MDLATQPMTEKNRDAYYWRLLATAASFALFGLGGLCLRLVIFPVLNWLPGDARTHRLRAR
QTVSRCFWIFVRFMARTGVLTYNIEGAEKLGRPGQMIIANHPSLIDVVFLIGLVRHANCV
VKQSLWENPFTRGPLRCTEYISNDGSMDMLDAAADALKDGQTLIIFPEGTRTQPGQPPAF
HRGGAAIALRGAKILTPVIIKVSPTTLTKAEPWYRIPKRRVHFSFRVGADIDPKTFATQG
PAPQASRKLNDYLHSYFIKELAEDERSEHP