Protein Info for PfGW456L13_2346 in Pseudomonas fluorescens GW456-L13

Annotation: glutamine ABC transporter ATP-binding component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 90 to 110 (21 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 14 to 115 (102 residues), 69.6 bits, see alignment E=1.3e-23 PF00528: BPD_transp_1" amino acids 35 to 218 (184 residues), 54.9 bits, see alignment E=1.5e-18 PF00005: ABC_tran" amino acids 277 to 428 (152 residues), 117.5 bits, see alignment E=1.1e-37

Best Hits

KEGG orthology group: None (inferred from 64% identity to kpn:KPN_02977)

Predicted SEED Role

"glutamine ABC transporter ATP-binding component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QMK2 at UniProt or InterPro

Protein Sequence (515 amino acids)

>PfGW456L13_2346 glutamine ABC transporter ATP-binding component (Pseudomonas fluorescens GW456-L13)
MQFDWSYFLSLFSLPDFWKACVTVVQLSALAWFIGMLLGFVLATAKLSHTPLLRIPAAVY
IWFFRSIPLLVLVVFVYNLPQLFPGSGPILSNPFYSGLLALVVTEAAYMAEIHRGGLISV
AKGQKEAGRALGIGLFGMQRLIVIPQAFRISLPTLINEYITVVKLTSLVSVISLTEILTV
GQRLYATNFLVMETLAAVGVYYVLIVTVFGFFLQRLERYLDLNFRKPHTLDAAAIANFRA
SAEALPDTARKAAGNNATPILQLKNIQKSYGTHQVLMGIDLNVEYGQVVSIIGPSGSGKT
SLIRTVNGLETIDTGDILLFGEKFIEASDKPNSTRLRKGVRHIGMVFQNFNLFPHRTILD
NVTLAPRYHGQPGELSEHRAYALLDKVGLLAHAHKYPHQLSGGQQQRVAIARALAMEPQI
MLFDEPTSALDPELVNDVLNVIRDLAKEGMTMLIVTHEMDFAMSISDRVVFMENGNIQLD
AAPETIRCDAEGERVRRFMGISARSPSRSATVDHA