Protein Info for PfGW456L13_2340 in Pseudomonas fluorescens GW456-L13

Annotation: Glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 536 PF13692: Glyco_trans_1_4" amino acids 312 to 443 (132 residues), 39 bits, see alignment E=9.5e-14 PF00534: Glycos_transf_1" amino acids 377 to 444 (68 residues), 32.6 bits, see alignment E=5.9e-12

Best Hits

KEGG orthology group: None (inferred from 64% identity to pag:PLES_58501)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QPC4 at UniProt or InterPro

Protein Sequence (536 amino acids)

>PfGW456L13_2340 Glycosyltransferase (Pseudomonas fluorescens GW456-L13)
MAVSPWDAMNFILYSDVNDSSISQSLGRPEYSYYFVLKAYRPLFESLGPVHVVSSAAEVD
PLYRQLQQAGQDCLFISFAPPHKTPTDLQCPMVCVVAWEFDTIPAEHWDNDPRQDWSQTL
ARLGRVITLSTHTAEAIRRTLGDDFPVLVLPTPLWERFADIRQQYPGTPVNAGATLQIKG
CILDSRSMGLSADGLIAPIIEQPPQEIAEPEPESEPEPEPSVPPLTLRRRLFITRHYLLL
WYREAVRDLVPDAVRPWLARFRTPQALPVEHAVGEAPAPDEPAISEPPVQDEHPQAAFPD
TSETVEIEVDGVIYVSVFNPDDGRKNWHHLITAFCWALRDVQDATLVLKMTQNDLSTYYV
ELMTLLSQLSPFACRVVVMHGYLQDEQFARLYGAASYYVNASRCEGLCLPLMEFMSCARP
VIAPNHTAMRDYIDERVAFVVKSSQEPTIWPEDARILYRTLRHRPDWGSLKTAYENSYAM
AKNQPDAWQAMADAASERMRQYCSFAPVQQRLALFFKQEPVRDVVPVVAETGAASC