Protein Info for PfGW456L13_2333 in Pseudomonas fluorescens GW456-L13

Annotation: Glycosyltransferase (EC 2.4.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 PF13439: Glyco_transf_4" amino acids 16 to 173 (158 residues), 42.1 bits, see alignment E=2.5e-14 PF00534: Glycos_transf_1" amino acids 195 to 350 (156 residues), 113.2 bits, see alignment E=2.5e-36 PF20706: GT4-conflict" amino acids 196 to 308 (113 residues), 54 bits, see alignment E=3.5e-18 PF13692: Glyco_trans_1_4" amino acids 199 to 339 (141 residues), 91.8 bits, see alignment E=1.2e-29 PF13524: Glyco_trans_1_2" amino acids 282 to 363 (82 residues), 29.5 bits, see alignment E=1.7e-10

Best Hits

KEGG orthology group: K12994, alpha-1,3-rhamnosyltransferase [EC: 2.4.1.-] (inferred from 82% identity to pfo:Pfl01_5687)

Predicted SEED Role

"Glycosyltransferase (EC 2.4.1.-)" (EC 2.4.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.-

Use Curated BLAST to search for 2.4.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QM05 at UniProt or InterPro

Protein Sequence (376 amino acids)

>PfGW456L13_2333 Glycosyltransferase (EC 2.4.1.-) (Pseudomonas fluorescens GW456-L13)
MRIALNARILQAPRTGIGHYVAELATALARESDVELSLFHGWGWSSTLPEAAMPGYSRLT
PLLRQIPGAYQARRWLEQKRFDQRPSQAIDLYHEPSLWPLSFNGPTIITLHDLTHLHYPD
TQPPARLREIERRLADGVQRARLILTDSQYIAEQAQAWFALPAERFVVAPLGVAARFHPR
EPEAIDQVLKAHGVEAREYFLCVGTLEPRKNLTLALRAHARLPETVRQRFPLLIAGMAGW
QRQQFNDELRSALASGHVCLLGYLSDDDLAQLLAGARALVFPSLYEGFGLPVLEAMASGT
PVILTGESAMPEVAGDAGNYIEAHDPDSLRDALLRLIDDPAHWQVCREAGLQRAKLFSWE
RCATVTARAYRQAMEN