Protein Info for PfGW456L13_2319 in Pseudomonas fluorescens GW456-L13

Annotation: Short-chain dehydrogenase, associated with 2-hydroxychromene-2-carboxylate isomerase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF00106: adh_short" amino acids 5 to 195 (191 residues), 125.8 bits, see alignment E=2.4e-40 PF08659: KR" amino acids 7 to 169 (163 residues), 31.8 bits, see alignment E=2e-11 PF13561: adh_short_C2" amino acids 17 to 223 (207 residues), 97.9 bits, see alignment E=1.1e-31

Best Hits

KEGG orthology group: None (inferred from 91% identity to pfo:Pfl01_3907)

Predicted SEED Role

"Short-chain dehydrogenase, associated with 2-hydroxychromene-2-carboxylate isomerase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QPA2 at UniProt or InterPro

Protein Sequence (242 amino acids)

>PfGW456L13_2319 Short-chain dehydrogenase, associated with 2-hydroxychromene-2-carboxylate isomerase family protein (Pseudomonas fluorescens GW456-L13)
MNNKKVVLIVGAGDATGGAIAKRFAREGFVTCVTRRSADKLQPLVDAIKADGGEAHGFAC
DARKEDDVVALVEQIESEIGPIEAFVFNIGANVPCSILEETARKYFKIWEMACFSGFLNA
REVAKRMAKRQRGTILFTGATAGLRGAAGFAAFAGAKHGIRALAQSMARELGPMNIHVAH
VVVDGAIDTDFIRDSFPEKYATKDQDGILNPEHIAENYWYLHSQPRDAWTFELDLRPWSE
RW