Protein Info for PfGW456L13_2288 in Pseudomonas fluorescens GW456-L13

Annotation: Citronellol and citronellal dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 PF00106: adh_short" amino acids 16 to 201 (186 residues), 151.1 bits, see alignment E=4.1e-48 PF08659: KR" amino acids 18 to 129 (112 residues), 50.9 bits, see alignment E=2.7e-17 PF13561: adh_short_C2" amino acids 24 to 253 (230 residues), 178.3 bits, see alignment E=2.9e-56

Best Hits

KEGG orthology group: K13774, citronellol/citronellal dehydrogenase (inferred from 89% identity to pfo:Pfl01_3946)

Predicted SEED Role

"Citronellol and citronellal dehydrogenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QJI1 at UniProt or InterPro

Protein Sequence (289 amino acids)

>PfGW456L13_2288 Citronellol and citronellal dehydrogenase (Pseudomonas fluorescens GW456-L13)
MAYDSIFKADLFAGQNIIVTGGGSGIGRCTAHELAALGAHVLLVGRNADKLKTVAAEIAD
DGGKADWSTCDIREEEAVTHLVSELIRKHGPIHGLVNNAGGQYPSPLASINQKGFETVMR
TNLVGGFLMAREVFNQSMSKHGGAIVNMLADMWGGMPGMGHSGAARSGMDNLTKTAAYEW
GHAGVRVNAVAPGWIASSGMDTYEGAFKAVIPTLREHVPLKRIGTESEVSAAIVFLLSPA
AAFVSGSTLRIDGAASLGGRAWPIHKATNSESYNGFHRAYIPDVLKDKE