Protein Info for PfGW456L13_2250 in Pseudomonas fluorescens GW456-L13

Annotation: Probable protease htpX homolog (EC 3.4.24.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 42 to 61 (20 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 195 to 219 (25 residues), see Phobius details PF01435: Peptidase_M48" amino acids 82 to 294 (213 residues), 126.6 bits, see alignment E=5.5e-41

Best Hits

Swiss-Prot: 97% identical to HTPX_PSEF5: Protease HtpX (htpX) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K03799, heat shock protein HtpX [EC: 3.4.24.-] (inferred from 98% identity to pba:PSEBR_a1628)

Predicted SEED Role

"Probable protease htpX homolog (EC 3.4.24.-)" (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QLR9 at UniProt or InterPro

Protein Sequence (296 amino acids)

>PfGW456L13_2250 Probable protease htpX homolog (EC 3.4.24.-) (Pseudomonas fluorescens GW456-L13)
MMRILLFLATNLAVVLIASITLSLFGFNGFMAANGVDLNLNQLLIFCAVFGFAGSLFSLF
ISKWMAKMSTSTQIITQPRTRHEQWLLQTVEQLSREAGIKMPEVGIFPAYEANAFATGWN
KNDALVAVSQGLLERFSPDEVKAVLAHEIGHVANGDMVTLALIQGVVNTFVMFFARIIGN
FVDKVIFKNEEGQGIAYYVATIFAELVLGILASAIVMWFSRKREFRADEAGANLAGTAAM
IGALQRLRAEQGLPVHMPDTLNAFGINGGIKQGFARMFMSHPPLEERIDALARRRG