Protein Info for PfGW456L13_2200 in Pseudomonas fluorescens GW456-L13

Annotation: dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF01370: Epimerase" amino acids 1 to 224 (224 residues), 204.2 bits, see alignment E=5.5e-64 TIGR01181: dTDP-glucose 4,6-dehydratase" amino acids 1 to 312 (312 residues), 465.7 bits, see alignment E=3.5e-144 PF16363: GDP_Man_Dehyd" amino acids 3 to 299 (297 residues), 276.7 bits, see alignment E=8.4e-86 PF04321: RmlD_sub_bind" amino acids 24 to 147 (124 residues), 34.9 bits, see alignment E=2.3e-12 PF02719: Polysacc_synt_2" amino acids 26 to 86 (61 residues), 32.4 bits, see alignment E=1.4e-11 PF07993: NAD_binding_4" amino acids 48 to 160 (113 residues), 29.8 bits, see alignment E=8.3e-11

Best Hits

Swiss-Prot: 78% identical to RMLB2_ECOLI: dTDP-glucose 4,6-dehydratase 2 (rffG) from Escherichia coli (strain K12)

KEGG orthology group: K01710, dTDP-glucose 4,6-dehydratase [EC: 4.2.1.46] (inferred from 91% identity to pfl:PFL_0305)

MetaCyc: 78% identical to dTDP-glucose 4,6-dehydratase 2 (Escherichia coli K-12 substr. MG1655)
dTDP-glucose 4,6-dehydratase. [EC: 4.2.1.46]

Predicted SEED Role

"dTDP-glucose 4,6-dehydratase (EC 4.2.1.46)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 4.2.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.46

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QX01 at UniProt or InterPro

Protein Sequence (333 amino acids)

>PfGW456L13_2200 dTDP-glucose 4,6-dehydratase (EC 4.2.1.46) (Pseudomonas fluorescens GW456-L13)
VLNLDKLTYAGNLESLTSIANDTRYEFVQADIVDQATVSAVLARFQPHAIMHLAAESHVD
RSIDGPSEFIQTNIVGTYSLLEAARAYWQALPEPEKSAFRFHHISTDEVYGDLHGVDDLF
TETTPYAPSSPYSASKAASDHLVRAWQRTYGLPVLLTNCSNNYGPFHFPEKLIPLVILNA
LAGKPLPVYGNGLQVRDWLFVEDHARALLKVVTTGTVGETYNIGGHNEQKNIDVVRGICA
LLEELAPHKPEGVAHYADLITFVQDRPGHDLRYAIDASKIERELGWVPEETFETGLRKTV
QWYLDNLEWCRRVQDGSYQGERLGAINPKELLA