Protein Info for PfGW456L13_2189 in Pseudomonas fluorescens GW456-L13

Annotation: UDP-2,3-diacetamido-2,3-dideoxy-D-mannuronic acid transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 86 to 106 (21 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details PF13579: Glyco_trans_4_4" amino acids 23 to 207 (185 residues), 35.1 bits, see alignment E=2.6e-12 PF00534: Glycos_transf_1" amino acids 227 to 389 (163 residues), 43.8 bits, see alignment E=3.2e-15 PF13692: Glyco_trans_1_4" amino acids 232 to 373 (142 residues), 46 bits, see alignment E=1e-15

Best Hits

KEGG orthology group: None (inferred from 72% identity to pba:PSEBR_a1568)

Predicted SEED Role

"UDP-2,3-diacetamido-2,3-dideoxy-D-mannuronic acid transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QLL0 at UniProt or InterPro

Protein Sequence (419 amino acids)

>PfGW456L13_2189 UDP-2,3-diacetamido-2,3-dideoxy-D-mannuronic acid transferase (Pseudomonas fluorescens GW456-L13)
VGMSENKLRILVVTQYFWPENMRINDLVRDFSDNGHEVTVLTGWPNYPEGAVFSEYKTNP
EGFKSYFGARIVRVPLVSRGKRSIRLMLNYLSFFFSASTIGAAKLRNEKFDAVFVYAVSP
IMAAIPAVVIGRMKKAPVYVWVLDLWPETLRAVGVLRNPTLLAMVGRVVSWIYNRADYLL
LQSEGFSSSVKQYCTKEISPERLVYFPSWAEDEFSGCPEKSSSLLERDDSTFTVVFAGNL
GDAQDLPAVLDAAESLKHSASVRWVIVGDGRMSKWLGEQVESRGLQNVLLLGRHPLSAMP
EIFACADALLVSLKTNDVFEKTVPGKVQAYLASSKPILGMINGEAARIIEDSGCGYTCPS
GDAQGLARITLKMATTDSVQREFMGQAGRSYYWSHFSKVTLLRRLEALFRAGTLRRDVK