Protein Info for PfGW456L13_2183 in Pseudomonas fluorescens GW456-L13

Annotation: WzxE protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 65 (23 residues), see Phobius details amino acids 77 to 100 (24 residues), see Phobius details amino acids 112 to 130 (19 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 170 to 189 (20 residues), see Phobius details amino acids 209 to 230 (22 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details amino acids 286 to 313 (28 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details amino acids 354 to 376 (23 residues), see Phobius details amino acids 382 to 402 (21 residues), see Phobius details PF13440: Polysacc_synt_3" amino acids 43 to 320 (278 residues), 36.1 bits, see alignment E=2.3e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QJ91 at UniProt or InterPro

Protein Sequence (419 amino acids)

>PfGW456L13_2183 WzxE protein (Pseudomonas fluorescens GW456-L13)
MIRPIINIGCQAVFKLMFAIASLKVVAFYVGPSGMAVVGQIQAFLQILSAGVSSVTTTGV
VKLIAEDKYPKERVLQSSLMLLLAFSFSFALVLLFSSTLISNFFLQGGWAEVLMLLPLGA
FFIGLNNLFISYFNGGQKYSEYFWYSVITAFFTALLTCACSIVFGKPGAVYSIALAPAIA
GVCVLLLPARFRLPRLNLVSLDVEVIKILLSYSLMALGSVVIVYGVQIVLRDYISTNGSM
AEAGTWYAVTRLSDIYMGICSVLFSTLLLPKYSSQEGRGLTSLVFRIGVMALGFVVVMAV
SVNVLASFAIWLIYGDAFAAATGIMKVYVIGDALKCLSWVFLYVMIAKQHVRFYLAYEML
SALLYLLFCVLCYRSYGFNNMAYGYPLQGAVSLTVVLIWFLVTRYNSTPLEQNNKYDAV