Protein Info for PfGW456L13_2149 in Pseudomonas fluorescens GW456-L13

Annotation: Protein of unknown function UPF0060

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 110 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 31 to 49 (19 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details PF02694: UPF0060" amino acids 4 to 106 (103 residues), 99.9 bits, see alignment E=4.7e-33

Best Hits

Swiss-Prot: 92% identical to Y4105_PSEPF: UPF0060 membrane protein Pfl01_4105 (Pfl01_4105) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K09771, hypothetical protein (inferred from 92% identity to pfo:Pfl01_4105)

Predicted SEED Role

"Protein of unknown function UPF0060"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293QP96 at UniProt or InterPro

Protein Sequence (110 amino acids)

>PfGW456L13_2149 Protein of unknown function UPF0060 (Pseudomonas fluorescens GW456-L13)
MLNYLWFFVAALFEIAGCFAFWMWLRQGKSMWWVVPALLSLTLFALLLTRIEATYAGRAY
AAYGGIYIIASIGWLAVVERIRPLGSDWLGVALCVIGASIILFGPRFSAS