Protein Info for PfGW456L13_2122 in Pseudomonas fluorescens GW456-L13

Annotation: L-arabinose transport system permease protein (TC 3.A.1.2.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 54 to 73 (20 residues), see Phobius details amino acids 79 to 96 (18 residues), see Phobius details amino acids 102 to 125 (24 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 170 to 191 (22 residues), see Phobius details amino acids 222 to 242 (21 residues), see Phobius details amino acids 256 to 289 (34 residues), see Phobius details amino acids 301 to 319 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 57 to 315 (259 residues), 124.3 bits, see alignment E=2.7e-40

Best Hits

Swiss-Prot: 63% identical to ARAH_SHIFL: L-arabinose transport system permease protein AraH (araH) from Shigella flexneri

KEGG orthology group: K10538, L-arabinose transport system permease protein (inferred from 98% identity to pfo:Pfl01_4139)

MetaCyc: 63% identical to arabinose ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-2-RXN [EC: 7.5.2.12, 7.5.2.13]

Predicted SEED Role

"L-arabinose transport system permease protein (TC 3.A.1.2.2)" in subsystem L-Arabinose utilization (TC 3.A.1.2.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.12 or 7.5.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A293Q7I9 at UniProt or InterPro

Protein Sequence (323 amino acids)

>PfGW456L13_2122 L-arabinose transport system permease protein (TC 3.A.1.2.2) (Pseudomonas fluorescens GW456-L13)
MMTTQNNTLPTTRKPLDLRRFLDDWVMLLAAVGIFVACTLLIDNFLSPLNMRGLGLAIST
TGIAACTMLYCLASGHFDLSVGSVIACAGVVAAVVMRDTNSVFLGVCAALVMGLIVGLIN
GIVIAKLRVNALITTLATMQIVRGLAYIFANGKAVGVSQESFFVFGNGQMFGVPVPILIT
IVCFLFFGWLLNYTTYGRNTMAIGGNQEAALLAGVNVDRTKIIIFAVHGVIGALAGVILA
SRMTSGQPMIGQGFELTVISACVLGGVSLSGGIGMIRHVIAGVLILAIIENAMNLKNIDT
FYQYVIRGSILLLAVVIDRLKQR